Lineage for d1ron__ (1ron -)
- Root: SCOP 1.57
- Class j: Peptides [58231] (84 folds)
- Fold j.6: Peptide hormones [58283] (1 superfamily)
- Superfamily j.6.1: Peptide hormones [58284] (1 family)
- Family j.6.1.1: Peptide hormones [58285] (9 proteins)
- Protein Neuropeptide Y [58289] (2 species)
- Species Human (Homo sapiens) [TaxId:9606] [58290] (1 PDB entry)
- Domain d1ron__: 1ron - [46090]
Details for d1ron__
PDB Entry: 1ron (more details)
PDB Description: nmr solution structure of human neuropeptide y
SCOP Domain Sequences for d1ron__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ron__ j.6.1.1 (-) Neuropeptide Y {Human (Homo sapiens)}
ypskpdnpgedapaedmaryysalrhyinlitrqry
SCOP Domain Coordinates for d1ron__ are not available.
Timeline for d1ron__:
- d1ron__ first appeared (with stable ids) in SCOP 1.55
- d1ron__ appears in SCOP 1.59
- d1ron__ appears in the current release, SCOPe 2.08, called d1rona_