PDB entry 1ron

View 1ron on RCSB PDB site
Description: nmr solution structure of human neuropeptide y
Deposited on 1996-01-11, released 1996-08-17
The last revision was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuropeptide y
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ronA (A:)
ypskpdnpgedapaedmaryysalrhyinlitrqry