![]() | Class j: Peptides [58231] (126 folds) |
![]() | Fold j.6: Peptide hormones [58283] (1 superfamily) contains one alpha-helix |
![]() | Superfamily j.6.1: Peptide hormones [58284] (1 family) ![]() this is not a true superfamily |
![]() | Family j.6.1.1: Peptide hormones [58285] (19 proteins) |
![]() | Protein Pancreatic polypeptide [58286] (2 species) |
![]() | Species Turkey (Meleagris gallopavo) [TaxId:9103] [58288] (2 PDB entries) Uniprot P68249 |
![]() | Domain d1ppta_: 1ppt A: [46089] complexed with zn |
PDB Entry: 1ppt (more details), 1.37 Å
SCOPe Domain Sequences for d1ppta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppta_ j.6.1.1 (A:) Pancreatic polypeptide {Turkey (Meleagris gallopavo) [TaxId: 9103]} gpsqptypgddapvedlirfydnlqqylnvvtrhry
Timeline for d1ppta_: