Lineage for d1ppta_ (1ppt A:)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1713367Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1713368Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1713369Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1713438Protein Pancreatic polypeptide [58286] (2 species)
  7. 1713443Species Turkey (Meleagris gallopavo) [TaxId:9103] [58288] (2 PDB entries)
    Uniprot P68249
  8. 1713445Domain d1ppta_: 1ppt A: [46089]
    complexed with zn

Details for d1ppta_

PDB Entry: 1ppt (more details), 1.37 Å

PDB Description: x-ray analysis (1.4-angstroms resolution) of avian pancreatic polypeptide. small globular protein hormone
PDB Compounds: (A:) avian pancreatic polypeptide

SCOPe Domain Sequences for d1ppta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppta_ j.6.1.1 (A:) Pancreatic polypeptide {Turkey (Meleagris gallopavo) [TaxId: 9103]}
gpsqptypgddapvedlirfydnlqqylnvvtrhry

SCOPe Domain Coordinates for d1ppta_:

Click to download the PDB-style file with coordinates for d1ppta_.
(The format of our PDB-style files is described here.)

Timeline for d1ppta_: