SCOP 1.67: Domain d1dylc_: 1dyl C:

Lineage for d1dylc_ (1dyl C:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein SFV capsid [58173] (1 species)

7. Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)

8. Domain d1dylc_: 1dyl C: [45965]

Details for d1dylc_

PDB Entry: 1dyl, 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density

SCOP Domain Sequences for d1dylc_:

Sequence; same for both SEQRES and ATOM records:

>d1dylc_ i.6.1.1 (C:) SFV capsid {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1dylc_:

• d1dylc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dylc_ appears in SCOP 1.65
  
• d1dylc_ appears in SCOP 1.69
  
• d1dylc_ appears in the current release, SCOPe 2.08