SCOPe 2.01: Domain d1dyla_: 1dyl A:

Lineage for d1dyla_ (1dyl A:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein SFV capsid [58173] (1 species)

7. Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)

8. Domain d1dyla_: 1dyl A: [45963]

Details for d1dyla_

PDB Entry: 1dyl, 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density

PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d1dyla_:

Sequence; same for both SEQRES and ATOM records:

>d1dyla_ i.6.1.1 (A:) SFV capsid {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1dyla_:

• d1dyla_ first appeared (with stable ids) in SCOP 1.55
  
• d1dyla_ appears in SCOP 1.75
  
• d1dyla_ appears in SCOPe 2.02
  
• d1dyla_ appears in the current release, SCOPe 2.08