Lineage for d1dgir_ (1dgi R:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649079Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 2649080Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 2649081Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 2649189Protein Poliovirus complexed with three domain CD155 [58169] (1 species)
  7. 2649190Species Human poliovirus type 1 [TaxId:12080] [58170] (2 PDB entries)
  8. 2649202Domain d1dgir_: 1dgi R: [45953]

Details for d1dgir_

PDB Entry: 1dgi (more details)

PDB Description: cryo-em structure of human poliovirus(serotype 1)complexed with three domain cd155
PDB Compounds: (R:) poliovirus receptor

SCOPe Domain Sequences for d1dgir_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgir_ i.6.1.1 (R:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
vvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyse
skrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqnt
aevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwil
vpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcda
rsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvq
v

SCOPe Domain Coordinates for d1dgir_:

Click to download the PDB-style file with coordinates for d1dgir_.
(The format of our PDB-style files is described here.)

Timeline for d1dgir_: