SCOPe 2.06: Domain d1d3ei_: 1d3e I:

Lineage for d1d3ei_ (1d3e I:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)

7. Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)

8. Domain d1d3ei_: 1d3e I: [45943]

Details for d1d3ei_

PDB Entry: 1d3e, 28 Å

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

PDB Compounds: (I:) protein (intercellular adhesion molecule-1)

SCOPe Domain Sequences for d1d3ei_:

Sequence; same for both SEQRES and ATOM records:

>d1d3ei_ i.6.1.1 (I:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16 [TaxId: 31708]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
qlqtf

Timeline for d1d3ei_:

• d1d3ei_ first appeared (with stable ids) in SCOP 1.55
  
• d1d3ei_ appears in SCOPe 2.05
  
• d1d3ei_ appears in SCOPe 2.07
  
• d1d3ei_ appears in the current release, SCOPe 2.08