Lineage for d1qo1t_ (1qo1 T:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 897676Fold i.3: ATP synthase [58140] (1 superfamily)
  4. 897677Superfamily i.3.1: ATP synthase [58141] (1 family) (S)
  5. 897678Family i.3.1.1: ATP synthase [58142] (1 protein)
  6. 897679Protein ATP synthase [58143] (3 species)
  7. 897680Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [58144] (1 PDB entry)
  8. 897698Domain d1qo1t_: 1qo1 T: [45902]

Details for d1qo1t_

PDB Entry: 1qo1 (more details), 3.9 Å

PDB Description: molecular architecture of the rotary motor in atp synthase from yeast mitochondria
PDB Compounds: (T:) ATP synthase protein 9

SCOP Domain Sequences for d1qo1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo1t_ i.3.1.1 (T:) ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

SCOP Domain Coordinates for d1qo1t_:

Click to download the PDB-style file with coordinates for d1qo1t_.
(The format of our PDB-style files is described here.)

Timeline for d1qo1t_: