SCOP 1.75: Domain d1qo1n_: 1qo1 N:

Lineage for d1qo1n_ (1qo1 N:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.3: ATP synthase [58140] (1 superfamily)

4. Superfamily i.3.1: ATP synthase [58141] (1 family)

5. Family i.3.1.1: ATP synthase [58142] (1 protein)

6. Protein ATP synthase [58143] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [58144] (1 PDB entry)

8. Domain d1qo1n_: 1qo1 N: [45896]

Details for d1qo1n_

PDB Entry: 1qo1, 3.9 Å

PDB Description: molecular architecture of the rotary motor in atp synthase from yeast mitochondria

PDB Compounds: (N:) ATP synthase protein 9

SCOP Domain Sequences for d1qo1n_:

Sequence; same for both SEQRES and ATOM records:

>d1qo1n_ i.3.1.1 (N:) ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

Timeline for d1qo1n_:

• d1qo1n_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo1n_ appears in SCOP 1.73
  
• d1qo1n_ appears in SCOPe 2.01
  
• d1qo1n_ appears in the current release, SCOPe 2.08