| Class i: Low resolution protein structures [58117] (17 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (2 species) |
| Species Escherichia coli [TaxId:562] [58123] (7 PDB entries) |
| Domain d1eg0j_: 1eg0 J: [45816] |
PDB Entry: 1eg0 (more details)
SCOP Domain Sequences for d1eg0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg0j_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
Timeline for d1eg0j_: