SCOPe 2.08: Domain d1eg0e_: 1eg0 E:

Lineage for d1eg0e_ (1eg0 E:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1eg0e_: 1eg0 E: [45811]
   Other proteins in same PDB: d1eg0a2

Details for d1eg0e_

PDB Entry: 1eg0, 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

PDB Compounds: (E:) protein (s8 ribosomal protein)

SCOPe Domain Sequences for d1eg0e_:

Sequence; same for both SEQRES and ATOM records:

>d1eg0e_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

Timeline for d1eg0e_:

• d1eg0e_ first appeared (with stable ids) in SCOP 1.55
  
• d1eg0e_ appears in SCOPe 2.07