Lineage for d1eg0b_ (1eg0 B:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2592943Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2592944Protein 70S ribosome functional complex [58121] (4 species)
  7. 2592945Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2593015Domain d1eg0b_: 1eg0 B: [45808]
    Other proteins in same PDB: d1eg0a2

Details for d1eg0b_

PDB Entry: 1eg0 (more details), 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome
PDB Compounds: (B:) protein (s5 ribosomal protein)

SCOPe Domain Sequences for d1eg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0b_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
lsksigsntpinmvratfdglkqlk

SCOPe Domain Coordinates for d1eg0b_:

Click to download the PDB-style file with coordinates for d1eg0b_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0b_: