Lineage for d2ezpb_ (2ezp B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205977Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. 206041Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 206042Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 206077Protein Retrovius gp41 protease-resistant core [58071] (3 species)
  7. 206097Species Simian immunodeficiency virus [58073] (10 PDB entries)
  8. 206109Domain d2ezpb_: 2ezp B: [45736]

Details for d2ezpb_

PDB Entry: 2ezp (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, models 1-10 of an ensemble of 40 simulated annealing structures

SCOP Domain Sequences for d2ezpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezpb_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezpb_:

Click to download the PDB-style file with coordinates for d2ezpb_.
(The format of our PDB-style files is described here.)

Timeline for d2ezpb_: