SCOP 1.75: Domain d1fav.1: 1fav A:,C:

Lineage for d1fav.1 (1fav A:,C:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (22 PDB entries)

8. Domain d1fav.1: 1fav A:,C: [45728]
   fusion protein between gp41 and GCN4 fragments; complex with a cell entry inhibitor

Details for d1fav.1

PDB Entry: 1fav, 3 Å

PDB Description: the structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core

PDB Compounds: (A:) hiv-1 envelope protein chimera, (C:) protein (transmembrane glycoprotein)

SCOP Domain Sequences for d1fav.1:

Sequence; same for both SEQRES and ATOM records:

>g1fav.1 h.3.2.1 (A:,C:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
iedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvwg
ikqlqarilaverylkdqXxexnnytslihslieesqnqqekneqellel

Timeline for d1fav.1:

• d1fav.1 first appeared (with stable ids) in SCOP 1.55
  
• d1fav.1 appears in SCOP 1.73
  
• d1fav.1 appears in SCOPe 2.01
  
• d1fav.1 appears in the current release, SCOPe 2.08