Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (1 family) |
Family h.3.2.1: Virus ectodomain [58070] (8 proteins) |
Protein Retrovius gp41 protease-resistant core [58071] (3 species) coiled coil; biological unit: trimer |
Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (19 PDB entries) |
Domain d1fav.1: 1fav A:,C: [45728] fusion protein between gp41 and GCN4 fragments; complex with a cell entry inhibitor |
PDB Entry: 1fav (more details), 3 Å
SCOP Domain Sequences for d1fav.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1fav.1 h.3.2.1 (A:,C:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]} iedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvwg ikqlqarilaverylkdqXxexnnytslihslieesqnqqekneqellel
Timeline for d1fav.1: