SCOP 1.75: Domain d1czqa_: 1czq A:

Lineage for d1czqa_ (1czq A:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (22 PDB entries)

8. Domain d1czqa_: 1czq A: [45720]
   fusion protein between gp41 and GCN4 fragments; complex with a d-peptide inhibitor of HIV-1 entry

Details for d1czqa_

PDB Entry: 1czq, 1.5 Å

PDB Description: crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.

PDB Compounds: (A:) fusion protein between the hydrophobic pocket of hiv gp41 and gcn4-piqi

SCOP Domain Sequences for d1czqa_:

Sequence; same for both SEQRES and ATOM records:

>d1czqa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

Timeline for d1czqa_:

• d1czqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1czqa_ appears in SCOP 1.73
  
• d1czqa_ appears in SCOPe 2.01
  
• d1czqa_ appears in the current release, SCOPe 2.08