Lineage for d1czqa_ (1czq A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042101Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 3042102Domain d1czqa_: 1czq A: [45720]
    fusion protein between gp41 and GCN4 fragments; complex with a d-peptide inhibitor of HIV-1 entry
    complexed with cl

Details for d1czqa_

PDB Entry: 1czq (more details), 1.5 Å

PDB Description: crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.
PDB Compounds: (A:) fusion protein between the hydrophobic pocket of hiv gp41 and gcn4-piqi

SCOPe Domain Sequences for d1czqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czqa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

SCOPe Domain Coordinates for d1czqa_:

Click to download the PDB-style file with coordinates for d1czqa_.
(The format of our PDB-style files is described here.)

Timeline for d1czqa_: