Lineage for d1df4a_ (1df4 A:)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1069044Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1069163Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 1069164Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 1069210Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 1069211Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (22 PDB entries)
  8. 1069212Domain d1df4a_: 1df4 A: [45719]

Details for d1df4a_

PDB Entry: 1df4 (more details), 1.45 Å

PDB Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
PDB Compounds: (A:) hiv-1 envelope glycoprotein gp41

SCOPe Domain Sequences for d1df4a_:

Sequence, based on SEQRES records: (download)

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
ivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihsliees
qn

Sequence, based on observed residues (ATOM records): (download)

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
ivqqqnnllraieaqqhllqltvwgikqlqaggwmewdreinnytslihslieesqn

SCOPe Domain Coordinates for d1df4a_:

Click to download the PDB-style file with coordinates for d1df4a_.
(The format of our PDB-style files is described here.)

Timeline for d1df4a_: