Lineage for d1flcd_ (1flc D:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272473Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 272474Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 272475Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 272476Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 272533Species Influenza C virus [TaxId:11552] [58068] (1 PDB entry)
  8. 272535Domain d1flcd_: 1flc D: [45717]
    Other proteins in same PDB: d1flca1, d1flca2, d1flcc1, d1flcc2, d1flce1, d1flce2

Details for d1flcd_

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

SCOP Domain Sequences for d1flcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flcd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza C virus}
iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti

SCOP Domain Coordinates for d1flcd_:

Click to download the PDB-style file with coordinates for d1flcd_.
(The format of our PDB-style files is described here.)

Timeline for d1flcd_: