Lineage for d1flcb_ (1flc B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969949Species Influenza C virus [TaxId:11552] [58068] (1 PDB entry)
  8. 1969950Domain d1flcb_: 1flc B: [45716]
    Other proteins in same PDB: d1flca1, d1flca2, d1flcc1, d1flcc2, d1flce1, d1flce2

Details for d1flcb_

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus
PDB Compounds: (B:) haemagglutinin-esterase-fusion glycoprotein

SCOPe Domain Sequences for d1flcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flcb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza C virus [TaxId: 11552]}
iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti

SCOPe Domain Coordinates for d1flcb_:

Click to download the PDB-style file with coordinates for d1flcb_.
(The format of our PDB-style files is described here.)

Timeline for d1flcb_: