SCOPe 2.05: Domain d1flce1: 1flc E:151-306

Lineage for d1flce1 (1flc E:151-306)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.3: Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49826] (1 protein)
   automatically mapped to Pfam PF02710

6. Protein Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49827] (1 species)
   includes irregular N- and C-terminal extensions

7. Species Influenza C virus [TaxId:11552] [49828] (1 PDB entry)

8. Domain d1flce1: 1flc E:151-306 [23839]
   Other proteins in same PDB: d1flca2, d1flcb_, d1flcc2, d1flcd_, d1flce2, d1flcf_

Details for d1flce1

PDB Entry: 1flc, 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

PDB Compounds: (E:) haemagglutinin-esterase-fusion glycoprotein

SCOPe Domain Sequences for d1flce1:

Sequence; same for both SEQRES and ATOM records:

>d1flce1 b.19.1.3 (E:151-306) Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 {Influenza C virus [TaxId: 11552]}
cmslvnaldktiplqvtagtagncnnsflknpalytqevkpsenkcgkenlafftlptqf
gtyecklhlvascyfiydskevynkrgcdnyfqviydsfgkvvggldnrvspytgnsgdt
ptmqcdmlqlkpgrysvrssprfllmpersycfdmk

Timeline for d1flce1:

• d1flce1 first appeared (with stable ids) in SCOP 1.55
  
• d1flce1 appears in SCOPe 2.04
  
• d1flce1 appears in SCOPe 2.06
  
• d1flce1 appears in the current release, SCOPe 2.08