Lineage for d1sfcf_ (1sfc F:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1466951Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 1466952Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)
  6. 1467002Protein Syntaxin 1A [88908] (3 species)
  7. 1467009Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 1467020Domain d1sfcf_: 1sfc F: [45648]
    Other proteins in same PDB: d1sfca_, d1sfcc_, d1sfcd_, d1sfce_, d1sfcg_, d1sfch_, d1sfci_, d1sfck_, d1sfcl_
    complex with synaptobrevin and SNAP-25 fragments
    complexed with mpd, sr

Details for d1sfcf_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex
PDB Compounds: (F:) protein (syntaxin 1a)

SCOPe Domain Sequences for d1sfcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfcf_ h.1.15.1 (F:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
sdtkkavkyqska

SCOPe Domain Coordinates for d1sfcf_:

Click to download the PDB-style file with coordinates for d1sfcf_.
(The format of our PDB-style files is described here.)

Timeline for d1sfcf_: