SCOP 1.55: Domain d1sfcf_: 1sfc F:

Lineage for d1sfcf_ (1sfc F:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
4. Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family)
5. Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein)
6. Protein Neuronal synaptic fusion complex [58040] (1 species)
7. Species Rat (Rattus norvegicus) [TaxId:10116] [58041] (2 PDB entries)
8. Domain d1sfcf_: 1sfc F: [45648]

Details for d1sfcf_

PDB Entry: 1sfc, 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfcf_:

Sequence; same for both SEQRES and ATOM records:

>d1sfcf_ h.1.15.1 (F:) Neuronal synaptic fusion complex {Rat (Rattus norvegicus)}
kqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
sdtkkavkyqska

SCOP Domain Coordinates for d1sfcf_ are not available.

Timeline for d1sfcf_:

• d1sfcf_ appears in SCOP 1.57
  
• d1sfcf_ appears in the current release, SCOPe 2.08