![]() | Class h: Coiled coil proteins [57942] (6 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (27 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen beta chain [88892] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88895] (13 PDB entries) |
![]() | Domain d1fzab2: 1fza B:148-199 [45621] Other proteins in same PDB: d1fzaa_, d1fzab1, d1fzac1, d1fzac2, d1fzad_, d1fzae1, d1fzaf1, d1fzaf2 |
PDB Entry: 1fza (more details), 2.9 Å
SCOP Domain Sequences for d1fzab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzab2 h.1.8.1 (B:148-199) Fibrinogen beta chain {Human (Homo sapiens)} khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzab2: