Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (27 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen beta chain [88892] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88895] (13 PDB entries) |
Domain d1fzee2: 1fze E:151-199 [45618] Other proteins in same PDB: d1fzea_, d1fzeb1, d1fzec1, d1fzec2, d1fzed_, d1fzee1, d1fzef1, d1fzef2 coiled-coil region only complexed with ca, nag |
PDB Entry: 1fze (more details), 3 Å
SCOP Domain Sequences for d1fzee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzee2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens)} lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzee2: