Lineage for d1fzef1 (1fze F:142-393)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421727Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 421728Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 421729Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 421730Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 421771Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (17 PDB entries)
  8. 421795Domain d1fzef1: 1fze F:142-393 [42479]
    Other proteins in same PDB: d1fzea_, d1fzeb2, d1fzec2, d1fzed_, d1fzee2, d1fzef2
    complexed with ca, nag

Details for d1fzef1

PDB Entry: 1fze (more details), 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin

SCOP Domain Sequences for d1fzef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzef1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOP Domain Coordinates for d1fzef1:

Click to download the PDB-style file with coordinates for d1fzef1.
(The format of our PDB-style files is described here.)

Timeline for d1fzef1: