SCOP 1.63: Domain d1fzeb2: 1fze B:151-199

Lineage for d1fzeb2 (1fze B:151-199)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
   in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails

7. Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries)

8. Domain d1fzeb2: 1fze B:151-199 [45615]
   Other proteins in same PDB: d1fzeb1, d1fzec1, d1fzee1, d1fzef1

Details for d1fzeb2

PDB Entry: 1fze, 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin

SCOP Domain Sequences for d1fzeb2:

Sequence; same for both SEQRES and ATOM records:

>d1fzeb2 h.1.8.1 (B:151-199) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1fzeb2:

• d1fzeb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzeb2 appears in SCOP 1.61
  
• d1fzeb2 appears in SCOP 1.65
  
• d1fzeb2 appears in the current release, SCOPe 2.08