SCOP 1.61: Domain d1fzfc2: 1fzf C:102-141

Lineage for d1fzfc2 (1fzf C:102-141)

1. Root: SCOP 1.61

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)

8. Domain d1fzfc2: 1fzf C:102-141 [45598]
   Other proteins in same PDB: d1fzfb1, d1fzfc1, d1fzfe1, d1fzff1

Details for d1fzfc2

PDB Entry: 1fzf, 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzfc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzfc2 h.1.8.1 (C:102-141) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzfc2:

• d1fzfc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzfc2 appears in SCOP 1.59
  
• d1fzfc2 appears in SCOP 1.63
  
• d1fzfc2 appears in the current release, SCOPe 2.08