SCOPe 2.04: Domain d1fbma_: 1fbm A:

Lineage for d1fbma_ (1fbm A:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family)

5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)

6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
   pentameric coiled-coil

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)

8. Domain d1fbma_: 1fbm A: [45585]
   complex with all-trans retinol
   complexed with rtl

Details for d1fbma_

PDB Entry: 1fbm, 2.7 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol

PDB Compounds: (A:) protein (cartilage oligomeric matrix protein)

SCOPe Domain Sequences for d1fbma_:

Sequence; same for both SEQRES and ATOM records:

>d1fbma_ h.1.7.1 (A:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

Timeline for d1fbma_:

• d1fbma_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbma_ appears in SCOPe 2.03
  
• d1fbma_ appears in SCOPe 2.05
  
• d1fbma_ appears in the current release, SCOPe 2.08