Lineage for d2tmaa_ (2tma A:)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.5: Tropomyosin [57997] (2 families) 
Family h.1.5.1: Tropomyosin [57998] (1 protein) Protein Tropomyosin [57999] (5 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [58000] (2 PDB entries) 
Domain d2tmaa_: 2tma A: [45571]
Details for d2tmaa_
PDB Entry: 2tma (more details), 15 Å
PDB Description: tropomyosin crystal structure and muscle regulation. appendix. construction of an atomic model for tropomyosin and implications for interactions with actin
PDB Compounds: (A:) tropomyosinSCOPe Domain Sequences for d2tmaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tmaa_ h.1.5.1 (A:) Tropomyosin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mdaikkkmqmlkldkenaldraeqaeadkkaaedrskqledelvslqkklkgtedeldky
sealkdaqeklelaekkatdaeadvaslnrriqlveeeldraqerlatalqkleeaekaa
desergmkviesraqkdeekmeiqeiqlkeakhiaedadrkyeevarklviiesdlerae
eraelsegkcaeleeeiktvtnnlksleaqaekysqkedkyeeeikvlsdklkeaetrae
faersvtkleksiddledelyaqklkykaiseeldhalndmtsi
SCOPe Domain Coordinates for d2tmaa_:
Click to download the PDB-style file with coordinates for d2tmaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tmaa_:
- d2tmaa_ first appeared (with stable ids) in SCOP 1.55
- d2tmaa_ appears in SCOPe 2.07
View in 3D
