Lineage for d1ifma_ (1ifm A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039834Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries)
    Uniprot P03621
  8. 3039838Domain d1ifma_: 1ifm A: [45557]

Details for d1ifma_

PDB Entry: 1ifm (more details), 3.3 Å

PDB Description: two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
PDB Compounds: (A:) inovirus

SCOPe Domain Sequences for d1ifma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifma_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka

SCOPe Domain Coordinates for d1ifma_:

Click to download the PDB-style file with coordinates for d1ifma_.
(The format of our PDB-style files is described here.)

Timeline for d1ifma_: