| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (13 proteins) |
| Protein C/ebp beta [57985] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [57986] (1 PDB entry) |
| Domain d1ci6b_: 1ci6 B: [45549] Other proteins in same PDB: d1ci6a_ heterodimer with Atf4 |
PDB Entry: 1ci6 (more details), 2.6 Å
SCOP Domain Sequences for d1ci6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci6b_ h.1.3.1 (B:) C/ebp beta {Mouse (Mus musculus)}
srdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfkql
Timeline for d1ci6b_: