SCOPe 2.08: Domain d1junb_: 1jun B:

Lineage for d1junb_ (1jun B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein C-jun [57975] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57976] (7 PDB entries)
   Uniprot P05412 253-314

8. Domain d1junb_: 1jun B: [45541]
   homodimer

Details for d1junb_

PDB Entry: 1jun

PDB Description: nmr study of c-jun homodimer

PDB Compounds: (B:) c-jun homodimer

SCOPe Domain Sequences for d1junb_:

Sequence; same for both SEQRES and ATOM records:

>d1junb_ h.1.3.1 (B:) C-jun {Human (Homo sapiens) [TaxId: 9606]}
cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny

Timeline for d1junb_:

• d1junb_ first appeared (with stable ids) in SCOP 1.55
  
• d1junb_ appears in SCOPe 2.07