Lineage for d1gd2g_ (1gd2 G:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 271981Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 271982Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 272109Protein PAP1 [57971] (1 species)
  7. 272110Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry)
  8. 272113Domain d1gd2g_: 1gd2 G: [45530]

Details for d1gd2g_

PDB Entry: 1gd2 (more details), 2 Å

PDB Description: crystal structure of bzip transcription factor pap1 bound to dna

SCOP Domain Sequences for d1gd2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd2g_ h.1.3.1 (G:) PAP1 {Fission yeast (Schizosaccharomyces pombe)}
qepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleee
lril

SCOP Domain Coordinates for d1gd2g_:

Click to download the PDB-style file with coordinates for d1gd2g_.
(The format of our PDB-style files is described here.)

Timeline for d1gd2g_: