Lineage for d1ztaa_ (1zta A:)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1246835Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1247023Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1247024Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1247090Protein GCN4 [57961] (2 species)
  7. 1247091Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (62 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1247174Domain d1ztaa_: 1zta A: [45509]

Details for d1ztaa_

PDB Entry: 1zta (more details)

PDB Description: the solution structure of a leucine-zipper motif peptide
PDB Compounds: (A:) leucine zipper monomer

SCOPe Domain Sequences for d1ztaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztaa_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqrmkqledkveellsknyhlenevarlkklvger

SCOPe Domain Coordinates for d1ztaa_:

Click to download the PDB-style file with coordinates for d1ztaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ztaa_: