Lineage for d1ysad_ (1ysa D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2265698Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2265699Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2265767Protein GCN4 [57961] (2 species)
  7. 2265768Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 2265883Domain d1ysad_: 1ysa D: [45508]
    protein/DNA complex

Details for d1ysad_

PDB Entry: 1ysa (more details), 2.9 Å

PDB Description: the gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex
PDB Compounds: (D:) protein (gcn4)

SCOPe Domain Sequences for d1ysad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysad_ h.1.3.1 (D:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvge

SCOPe Domain Coordinates for d1ysad_:

Click to download the PDB-style file with coordinates for d1ysad_.
(The format of our PDB-style files is described here.)

Timeline for d1ysad_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ysac_