Lineage for d1swia_ (1swi A:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708349Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1708350Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1708418Protein GCN4 [57961] (2 species)
  7. 1708419Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (63 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1708596Domain d1swia_: 1swi A: [45503]
    trimeric mutant complexed with benzene
    complexed with bnz; mutant

Details for d1swia_

PDB Entry: 1swi (more details), 2.6 Å

PDB Description: gcn4-leucine zipper core mutant as n16a complexed with benzene
PDB Compounds: (A:) gcn4p1

SCOPe Domain Sequences for d1swia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swia_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvg

SCOPe Domain Coordinates for d1swia_:

Click to download the PDB-style file with coordinates for d1swia_.
(The format of our PDB-style files is described here.)

Timeline for d1swia_: