Lineage for d1zila_ (1zil A:)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1067938Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1068126Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1068127Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1068193Protein GCN4 [57961] (2 species)
  7. 1068194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (62 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1068242Domain d1zila_: 1zil A: [45498]
    mutant

Details for d1zila_

PDB Entry: 1zil (more details), 2.25 Å

PDB Description: gcn4-leucine zipper core mutant asn16gln in the dimeric state
PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d1zila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zila_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskqyhlenevarlkklv

SCOPe Domain Coordinates for d1zila_:

Click to download the PDB-style file with coordinates for d1zila_.
(The format of our PDB-style files is described here.)

Timeline for d1zila_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zilb_