Lineage for d1zimc_ (1zim C:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 344989Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 344990Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 345042Protein GCN4 [57961] (1 species)
  7. 345043Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 345085Domain d1zimc_: 1zim C: [45489]
    trimeric mutant

Details for d1zimc_

PDB Entry: 1zim (more details), 2 Å

PDB Description: gcn4-leucine zipper core mutant asn16gln in the trimeric state

SCOP Domain Sequences for d1zimc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zimc_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskqyhlenevarlkklvge

SCOP Domain Coordinates for d1zimc_:

Click to download the PDB-style file with coordinates for d1zimc_.
(The format of our PDB-style files is described here.)

Timeline for d1zimc_: