| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (14 proteins) |
| Protein GCN4 [57961] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries) |
| Domain d1zimb_: 1zim B: [45488] |
PDB Entry: 1zim (more details), 2 Å
SCOP Domain Sequences for d1zimb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zimb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskqyhlenevarlkklvge
Timeline for d1zimb_: