Lineage for d1ziib_ (1zii B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644061Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2644062Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2644130Protein GCN4 [57961] (2 species)
  7. 2644131Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 2644169Domain d1ziib_: 1zii B: [45480]
    mutant

Details for d1ziib_

PDB Entry: 1zii (more details), 1.8 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the dimeric state
PDB Compounds: (B:) General control protein GCN4

SCOPe Domain Sequences for d1ziib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ziib_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvg

SCOPe Domain Coordinates for d1ziib_:

Click to download the PDB-style file with coordinates for d1ziib_.
(The format of our PDB-style files is described here.)

Timeline for d1ziib_:

2644169
d1ziib_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ziia_