SCOPe 2.04: Domain d1ziib_: 1zii B:

Lineage for d1ziib_ (1zii B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein GCN4 [57961] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (63 PDB entries)
   Uniprot P03069 249-279 ! Uniprot P03069 249-281

8. Domain d1ziib_: 1zii B: [45480]
   mutant

Details for d1ziib_

PDB Entry: 1zii, 1.8 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the dimeric state

PDB Compounds: (B:) General control protein GCN4

SCOPe Domain Sequences for d1ziib_:

Sequence; same for both SEQRES and ATOM records:

>d1ziib_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvg

Timeline for d1ziib_:

• d1ziib_ first appeared (with stable ids) in SCOP 1.55
  
• d1ziib_ appears in SCOPe 2.03
  
• d1ziib_ appears in SCOPe 2.05
  
• d1ziib_ appears in the current release, SCOPe 2.08