Lineage for d1ziib_ (1zii B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205527Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 205528Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 205570Protein GCN4 [57961] (1 species)
  7. 205571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 205574Domain d1ziib_: 1zii B: [45480]

Details for d1ziib_

PDB Entry: 1zii (more details), 1.8 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the dimeric state

SCOP Domain Sequences for d1ziib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ziib_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvg

SCOP Domain Coordinates for d1ziib_:

Click to download the PDB-style file with coordinates for d1ziib_.
(The format of our PDB-style files is described here.)

Timeline for d1ziib_:

205574
d1ziib_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ziia_