Lineage for d2ztab_ (2zta B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205527Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 205528Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 205570Protein GCN4 [57961] (1 species)
  7. 205571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 205578Domain d2ztab_: 2zta B: [45475]

Details for d2ztab_

PDB Entry: 2zta (more details), 1.8 Å

PDB Description: x-ray structure of the gcn4 leucine zipper, a two-stranded, parallel coiled coil

SCOP Domain Sequences for d2ztab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ztab_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvg

SCOP Domain Coordinates for d2ztab_:

Click to download the PDB-style file with coordinates for d2ztab_.
(The format of our PDB-style files is described here.)

Timeline for d2ztab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ztaa_