SCOP 1.63: Domain d1b08b2: 1b08 B:1205-1234

Lineage for d1b08b2 (1b08 B:1205-1234)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (1 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (2 PDB entries)

8. Domain d1b08b2: 1b08 B:1205-1234 [45424]
   Other proteins in same PDB: d1b08a1, d1b08b1, d1b08c1

Details for d1b08b2

PDB Entry: 1b08, 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)

SCOP Domain Sequences for d1b08b2:

Sequence; same for both SEQRES and ATOM records:

>d1b08b2 h.1.1.1 (B:1205-1234) Surfactant protein {Human (Homo sapiens), SP-D}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d1b08b2:

• d1b08b2 first appeared (with stable ids) in SCOP 1.55
  
• d1b08b2 appears in SCOP 1.61
  
• d1b08b2 appears in SCOP 1.65
  
• d1b08b2 appears in the current release, SCOPe 2.08