| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (15 PDB entries) |
| Domain d1b08a2: 1b08 A:204-234 [45423] Other proteins in same PDB: d1b08a1, d1b08b1, d1b08c1 complexed with ca |
PDB Entry: 1b08 (more details), 2.3 Å
SCOPe Domain Sequences for d1b08a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b08a2 h.1.1.1 (A:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d1b08a2:
View in 3DDomains from other chains: (mouse over for more information) d1b08b1, d1b08b2, d1b08c1, d1b08c2 |