SCOPe 2.04: Domain d1zbdb_: 1zbd B:

Lineage for d1zbdb_ (1zbd B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)

6. Protein Effector domain of rabphilin-3a [57909] (1 species)
   contains additional N-terminal long alpha-helix

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57910] (1 PDB entry)

8. Domain d1zbdb_: 1zbd B: [45359]
   Other proteins in same PDB: d1zbda_
   complexed with gtp, mg, zn

Details for d1zbdb_

PDB Entry: 1zbd, 2.6 Å

PDB Description: structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a

PDB Compounds: (B:) rabphilin-3a

SCOPe Domain Sequences for d1zbdb_:

Sequence; same for both SEQRES and ATOM records:

>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeltdeekeiinrviaraekmetmeqerigrlvdrletmrknvagdgvnrcilcgeqlgm
lgsasvvcedckknvctkcgvetsnnrphpvwlckicleqrevwkrsgawffkgfpkqvl
pqpm

Timeline for d1zbdb_:

• d1zbdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1zbdb_ appears in SCOPe 2.03
  
• d1zbdb_ appears in SCOPe 2.05
  
• d1zbdb_ appears in the current release, SCOPe 2.08