Lineage for d1dvpa2 (1dvp A:149-220)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) Superfamily g.50.1: FYVE/PHD zinc finger [57903] (2 families) 
Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (4 proteins) 
Protein Hrs [57907] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57908] (1 PDB entry) 
Domain d1dvpa2: 1dvp A:149-220 [45358]
Other proteins in same PDB: d1dvpa1
Details for d1dvpa2
PDB Entry: 1dvp (more details), 2 Å
PDB Description: crystal structure of the vhs and fyve tandem domains of hrs, a protein involved in membrane trafficking and signal transduction
SCOP Domain Sequences for d1dvpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster)}
mftadtapnwadgrvchrcrveftftnrkhhcrncgqvfcgqctakqcplpkygiekevr
vcdgcfaalqrg
SCOP Domain Coordinates for d1dvpa2:
Click to download the PDB-style file with coordinates for d1dvpa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dvpa2:
View in 3D
