SCOP 1.55: Domain d1dvpa2: 1dvp A:149-220

Lineage for d1dvpa2 (1dvp A:149-220)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (2 families)

5. Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (3 proteins)

6. Protein Hrs [57907] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57908] (1 PDB entry)

8. Domain d1dvpa2: 1dvp A:149-220 [45358]
   Other proteins in same PDB: d1dvpa1

Details for d1dvpa2

PDB Entry: 1dvp, 2 Å

PDB Description: crystal structure of the vhs and fyve tandem domains of hrs, a protein involved in membrane trafficking and signal transduction

SCOP Domain Sequences for d1dvpa2:

Sequence; same for both SEQRES and ATOM records:

>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster)}
mftadtapnwadgrvchrcrveftftnrkhhcrncgqvfcgqctakqcplpkygiekevr
vcdgcfaalqrg

Timeline for d1dvpa2:

• d1dvpa2 appears in SCOP 1.57
  
• d1dvpa2 appears in the current release, SCOPe 2.08