Lineage for d1bor__ (1bor -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily) Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) 
Family g.44.1.1: RING finger domain, C3HC4 [57851] (6 proteins) 
Protein Acute promyelocytic leukaemia proto-onkoprotein PML [57858] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57859] (1 PDB entry) 
Domain d1bor__: 1bor - [45324]
Details for d1bor__
PDB Entry: 1bor (more details)
PDB Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
SCOP Domain Sequences for d1bor__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bor__ g.44.1.1 (-) Acute promyelocytic leukaemia proto-onkoprotein PML {Human (Homo sapiens)}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal
SCOP Domain Coordinates for d1bor__:
Click to download the PDB-style file with coordinates for d1bor__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bor__:
- d1bor__ first appeared (with stable ids) in SCOP 1.55
- d1bor__ appears in SCOP 1.59
- d1bor__ appears in the current release, SCOPe 2.08, called d1bora_
View in 3D