Lineage for d1bor__ (1bor -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90744Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
  4. 90745Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 90746Family g.44.1.1: RING finger domain, C3HC4 [57851] (6 proteins)
  6. 90747Protein Acute promyelocytic leukaemia proto-onkoprotein PML [57858] (1 species)
  7. 90748Species Human (Homo sapiens) [TaxId:9606] [57859] (1 PDB entry)
  8. 90749Domain d1bor__: 1bor - [45324]

Details for d1bor__

PDB Entry: 1bor (more details)

PDB Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc

SCOP Domain Sequences for d1bor__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bor__ g.44.1.1 (-) Acute promyelocytic leukaemia proto-onkoprotein PML {Human (Homo sapiens)}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal

SCOP Domain Coordinates for d1bor__:

Click to download the PDB-style file with coordinates for d1bor__.
(The format of our PDB-style files is described here.)

Timeline for d1bor__: